PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_14962_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 287aa    MW: 32763.5 Da    PI: 7.8223
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_14962_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.44.5e-151462148
                                          TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                                          +g+W++eEd +l+ ++++ G g +W + ++++g++R++k+c++rw++yl
  cra_locus_14962_iso_2_len_1049_ver_3 14 KGPWSPEEDAKLKSYIEKNGIGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                                          79******************999************************97 PP

2Myb_DNA-binding36.11.5e-1169111246
                                           SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                       Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                           g +++eEd ++  +    G++ W+ Ia  ++ gRt++++k++w++
  cra_locus_14962_iso_2_len_1049_ver_3  69 GGFSEEEDHIICSLYLSIGSR-WSIIAGQLP-GRTDNDIKNYWNT 111
                                           569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.692962IPR017930Myb domain
SuperFamilySSF466891.8E-2611109IPR009057Homeodomain-like
SMARTSM007174.5E-111364IPR001005SANT/Myb domain
PfamPF002497.8E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-241569IPR009057Homeodomain-like
CDDcd001673.41E-81662No hitNo description
PROSITE profilePS5129420.59663117IPR017930Myb domain
SMARTSM007171.7E-867115IPR001005SANT/Myb domain
PfamPF002494.6E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.3E-2370117IPR009057Homeodomain-like
CDDcd001672.07E-571113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
XGRAPCCDKA NVKKGPWSPE EDAKLKSYIE KNGIGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDHIIC SLYLSIGSRW SIIAGQLPGR TDNDIKNYWN TRLKKKLLGS  120
KQRYKNQIRT NIPSSVKQEE IHEREIIDNN AFVTNQFQQS LALAAAAPIF QDQEQFGGSN  180
LISEGQFDTS LINSMMINGT NGTTTTSNYF DNYYNGQSMM MMMSSGSFNA TDDYYNINIS  240
EQIWEGGLDQ SFSSLQNYEN SIQDYCTIHE YSRKLQMQHP HYNTVLQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-24141177108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010245646.13e-82PREDICTED: transcription factor RAX3
RefseqXP_010647487.11e-82PREDICTED: transcription factor RAX3
TrEMBLJ7FAY53e-84J7FAY5_QUESU; R2R3-MYB transcription factor MYB1.1
TrEMBLJ7FAJ64e-84J7FAJ6_QUESU; R2R3-MYB transcription factor MYB1.2
STRINGVIT_00s1352g00010.t014e-82(Vitis vinifera)